IQCK Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IQCK Polyclonal antibody (25740-1-AP)

IQCK Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25740-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

IQ domain containing protein K, IQ motif containing K, IQCK

• 

  WB analysis of mouse testis using 25740-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25740-1-AP (IQCK Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 25740-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25740-1-AP (IQCK Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 25740-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25740-1-AP (IQCK Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 25740-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25740-1-AP (IQCK Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 25740-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25740-1-AP (IQCK Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of COLO 320 using 25740-1-AP

  Immunofluorescent analysis of COLO 320 cells using 25740-1-AP (IQCK antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IQCK in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue
• Positive IHC detected in: human colon cancer tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: COLO 320 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25740-1-AP targets IQCK in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22680

  Product name: Recombinant human IQCK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-287 aa of BC034823

  Sequence: MAAPRQIPSHIVRLKPSCSTDSSFTRTPVPTVSLASRELPVSSWQVTEPSSKNLWEQICKEYEAEQPPFPEGYKVKQEPVITVAPVEEMLFHGFSAEHYFPVSHFTMISRTPCPQDKSETINPKTCSPKEYLETFIFPVLLPGMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIPFVEERLKQHPRPPIPLSLLLTEEEAALYIQSFWRACVVRCDPEIQELRQWQKKLREAKHIHQQVKIFWAKQEQKVKCKMEDDAVPAAKMKIPSS

• Full Name: IQ motif containing K
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC034823
• Gene Symbol: IQCK
• Gene ID (NCBI): 124152
• RRID: AB_2880220
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N0W5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Antibody: Anti-IQCK (IQ motif containing protein K)
Catalog No.: 25740-1-AP
Total Citations: 1

This antibody has been cited in Frontiers in Cellular Neuroscience (IF 4.4). The cited study investigated IQCK as a novel Alzheimer's disease risk factor, demonstrating its abundant expression in the brain and marked increase in Alzheimer's patients. Applications used include IHC, WB, and IF in human and mouse samples. The research field is neuroscience / neurodegenerative disease (Alzheimer's disease).

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	IHC,WB,IF	Front Cell Neurosci; Novel Alzheimer risk factor IQ motif containing protein K is abundantly expressed in the brain and is markedly increased in patients with Alzheimer's disease.; Authors - Hongjie Wang