IRF9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IRF9 Polyclonal antibody (14167-1-AP)

• Featured Product
• KD/KO Validated

IRF9 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14167-1-AP Copied!

Publications (53)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Synonyms

IFN-alpha-responsive transcription factor subunit, Interferon-stimulated gene factor 3 gamma, IRF 9, IRF-9, ISGF-3 gamma

• 

  WB analysis using 14167-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14167-1-AP (IRF9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14167-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14167-1-AP (IRF9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 14167-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14167-1-AP (IRF9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat heart using 14167-1-AP

  rat heart tissue were subjected to SDS PAGE followed by western blot with 14167-1-AP (IRF9 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse heart using 14167-1-AP

  IP result of anti-IRF9 (IP:14167-1-AP, 4ug; Detection:14167-1-AP 1:500) with mouse heart tissue lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 14167-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 14167-1-AP (IRF9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 14167-1-AP

  Immunofluorescent analysis of HepG2 cells, using IRF9 antibody 14167-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IRF9 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, mouse heart tissue, rat heart tissue, HepG2 cells, MCF-7 cells, HeLa cells, THP-1 cells
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14167-1-AP targets IRF9 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, canine, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5365

  Product name: Recombinant human IRF9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-393 aa of BC035716

  Sequence: MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV

• Full Name: IRF 9
• Calculated Molecular Weight: 393 aa, 44 kDa
• Observed Molecular Weight: 44-48 kDa
• GenBank Accession Number: BC035716
• Gene Symbol: IRF9
• Gene ID (NCBI): 10379
• RRID: AB_2296227
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00978
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IRF9 also named ISGF3 is a transcription regulatory factor that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of IFN stimulated genes, which drive the cell in an antiviral state.

Publications

What published studies show

The IRF9 antibody (Cat# 14167-1-AP) has 53 citations spanning journals including Nature, Cell, Nature Metabolism, Nature Communications, Molecular Cell, EMBO Reports, and the Journal of Biological Chemistry. Research fields covered include interferon signaling and innate immunity, oncology (glioblastoma, breast, lung, pancreatic, bladder, and renal cancers), viral infections (African swine fever, SARS-CoV-2, influenza, herpes), neurodegeneration (Parkinson's, Alzheimer's), liver fibrosis, cardiovascular disease, and inflammatory disorders.

Automatically generated from the 53 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Nature; Divergent transcriptional regulation of astrocyte reactivity across disorders.; Authors - Joshua E Burda
human	WB	Cell; Human IRF1 governs macrophagic IFN-γ immunity to mycobacteria; Authors - Jérémie Rosain
human	WB,ChIP	Nat Cancer; The IRENA lncRNA converts chemotherapy-polarized tumor-suppressing macrophages to tumor-promoting phenotypes in breast cancer.; Authors - Jiang Liu ; KD Validated
mouse	WB	Nat Metab; Mitochondrial DNA Stress Signalling Protects the Nuclear Genome.; Authors - Zheng Wu ; KD Validated
human	WB,IF	Gut; ISG15 deficiency in hepatic stellate cells promotes TGFβ2-induced liver fibrosis by counteracting CREB1 ISGylation; Authors - Yue Yuan
human	WB,IHC	Nat Commun; Targeting leucine-rich repeat kinase 2 overcomes resistance to oncolytic herpes simplex virus-based therapies in glioblastoma.; Authors - Yaning Qin