IRX1 Polyclonal antibody

• 

  WB analysis using 31699-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31699-1-AP (IRX1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

IRX1 Polyclonal Antibody for WB, ELISA

Cat No. 31699-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

IRXA1, IRX-5, IRX 5

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, C2C12 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31699-1-AP targets IRX1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36597

  Product name: Recombinant human IRX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 190-300 aa of BC166635

  Sequence: KVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDSPLGLAKEAPEPGSTRLLSPG

• Full Name: iroquois homeobox 1
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC166635
• Gene Symbol: IRX1
• Gene ID (NCBI): 79192
• RRID: AB_3670085
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P78414
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Iroquois homeobox protein 1 (IRX1) is a member of the Iroquois homeobox family of transcription factors which plays a crucial role in embryonic development. IRX1 has been previously shown to function as a potential tumor suppressor in rheumatoid arthritis (RA), congenital heart disease (CHD), and tumors, such as gastric cancer (GC) and osteosarcoma (PMID: 25822025, PMID:  31640472). The molecular weight of IRX1 is 50 kDa.