Tested Applications
| Positive WB detected in | mouse lung tissue, rat blood, mouse spleen tissue, rat spleen tissue, human blood tissue |
| Positive IP detected in | human plasma tissue |
| Positive IHC detected in | mouse spleen tissue, human spleen tissue, rat spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:15000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24552-1-AP targets CD41 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19459 Product name: Recombinant human CD41/Integrin alpha 2b protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 678-894 aa of BC126442 Sequence: AELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFL Predict reactive species |
| Full Name | integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) |
| Calculated Molecular Weight | 1039 aa, 113 kDa |
| Observed Molecular Weight | 110-125 kDa |
| GenBank Accession Number | BC126442 |
| Gene Symbol | CD41 |
| Gene ID (NCBI) | 3674 |
| RRID | AB_2879604 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08514 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID: 19118207). Integrin alpha-IIb (ITGA2B, CD41) is expressed on platelets, megakaryocytes and some hematopoietic progenitor cells (PMID: 11934866). This protein undergoes post-translational cleavage to yield disulfide linked light beta (25 kDa) and heavy alpha (125 kDa) chains, which join with integrin beta3 (CD61) to form a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. CD41/CD61 is crucial for platelet aggregation through binding of soluble fibrinogen.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CD41 antibody 24552-1-AP | Download protocol |
| IP protocol for CD41 antibody 24552-1-AP | Download protocol |
| WB protocol for CD41 antibody 24552-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD41 Polyclonal antibody (Cat# 24552-1-AP), targeting ITGA2B (Integrin αIIb), has 74 citations in journals including Nature Immunology, Nature Communications, Blood, Science Translational Medicine, Journal of Clinical Investigation, Advanced Science, Theranostics, and ACS Nano. Research fields span platelet biology, thrombosis, hematology, cancer immunotherapy, cardiovascular disease, inflammation, tissue engineering, and liver fibrosis.
| Species | Application | Title |
|---|---|---|
Nat Immunol Tumor cell-released kynurenine biases MEP differentiation into megakaryocytes in individuals with cancer by activating AhR-RUNX1 | ||
Bioact Mater Sequential simulation of regeneration-specific microenvironments using scaffolds loaded with nanoplatelet vesicles enhances bone regeneration | ||
Bioact Mater A large puncture closer of aortic wall by multi-memory actions with thrombo-hemodynamic control. | ||
Sci Bull (Beijing) Engineered platelets-based nano-aircraft system for precise tumor chemo-immunotherapy with graded drug delivery and self-recognized tumor targeting | ||
Nat Commun Prussian blue nanoparticles targeting multiple PANoptosome-mediated PANoptosis for myocardial ischemia-reperfusion injury therapy. |
