Mouse IL-10 Recombinant monoclonal antibody, PBS Only

• 

IL-10 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 82191-6-PBS

Clone No.240430F2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Indirect ELISA

Synonyms

Il10, IL-10,IL10, CSIF, Il 10, interleukin 10

---

Product Information

82191-6-PBS targets IL-10 in Cytometric bead array, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0026

  Product name: Recombinant Mouse IL-10 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: N-6*his

  Domain: 19-178 aa of NM_010548

  Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

• Full Name: interleukin 10
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: NM_010548
• Gene Symbol: Il10
• Gene ID (NCBI): 16153
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P18893
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.