Inhibin alpha Polyclonal antibody, PBS Only

• 

  WB analysis using 27331-1-AP (same clone as 27331-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27331-1-AP (Inhibin alpha antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27331-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 27331-1-AP (same clone as 27331-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 27331-1-AP (Inhibin alpha antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27331-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 27331-1-AP (same clone as 27331-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 27331-1-AP (Inhibin alpha antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27331-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 27331-1-AP (same clone as 27331-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27331-1-AP (Inhibin alpha antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27331-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 27331-1-AP (same clone as 27331-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27331-1-AP (Inhibin alpha antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27331-1-PBS in a different storage buffer formulation.

Inhibin alpha Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27331-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

INHA, Inhibin A, Inhibin α, Inhibin-A, Inhibinα

---

Product Information

27331-1-PBS targets Inhibin alpha in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25999

  Product name: Recombinant human INHA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 233-366 aa of BC006391

  Sequence: STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI

• Full Name: inhibin, alpha
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC006391
• Gene Symbol: Inhibin alpha
• Gene ID (NCBI): 3623
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05111
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Inhibin, a heterodimeric member of the TGF family, consists of an alpha (α) subunit (coded by INHA) and a beta (β) subunit, which combine to produce either inhibin A (αβA) or inhibin B (αβB). Inhibin complexes negatively regulate follicle stimulating hormone secretion from the pituitary gland. Inhibins have also been implicated in regulating numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion.