Integrin Beta 1/CD29 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Integrin Beta 1/CD29 Polyclonal antibody (26918-1-AP)

• Featured Product
• KD/KO Validated

Integrin Beta 1/CD29 Polyclonal Antibody for WB, ELISA

Cat No. 26918-1-AP

Publications(48)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IP, ELISA

Synonyms

ITGB1, CD29, FNRB, Glycoprotein IIa, GPIIA

• 

  WB analysis using 26918-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26918-1-AP (Integrin Beta 1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 26918-1-AP

  WB result of Integrin Beta 1/CD29 antibody (26918-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-Integrin Beta 1/CD29 transfected A549 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HT-1080 using 26918-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 26918-1-AP (Integrin beta-1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse lung tissue, A549 cells, HT-1080 cells, rat lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26918-1-AP targets Integrin Beta 1/CD29 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25426

  Product name: Recombinant human Integrin beta-1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 752-798 aa of BC020057

  Sequence: KLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK

• Full Name: integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
• Calculated Molecular Weight: 88 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC020057
• Gene Symbol: Integrin beta 1
• Gene ID (NCBI): 3688
• ENSEMBL Gene ID: ENSG00000150093
• RRID: AB_2880685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05556
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse		Mil Med Res; Single-cell transcriptomic dissection of the cellular and molecular events underlying the triclosan-induced liver fibrosis in mice; Authors - Yun-Meng Bai
rat	IP	Nat Metab; Early-activated extracellular matrix proteins shape the metabolic and spatial dynamics of the kidney fibrotic microenvironment.; Authors - Yuan Gui
human		Bioact Mater; Step-wise CAG@PLys@PDA-Cu2+ modification on micropatterned nanofibers for programmed endothelial healing; Authors - Bingcheng Yi
human	WB	Nat Commun; Regulation of local GTP availability controls RAC1 activity and cell invasion; Authors - Anna Bianchi-Smiraglia
rat,mouse	WB,IHC	Nat Commun; In situ osteogenic activation of mesenchymal stem cells by the blood clot biomimetic mechanical microenvironment; Authors - Wangxiao He
human	WB	J Adv Res; ST6GALNAC1-mediated sialylation in uterine endometrial epithelium facilitates the epithelium-embryo attachment; Authors - Xinyue Dong