Integrin Beta 1/CD29 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Integrin Beta 1/CD29 Polyclonal antibody (26918-1-AP)

• Featured Product
• KD/KO Validated

Integrin Beta 1/CD29 Polyclonal Antibody for WB, ELISA

Cat No. 26918-1-AP Copied!

Publications (48)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IP, ELISA

Synonyms

ITGB1, CD29, FNRB, Glycoprotein IIa, GPIIA

• 

  WB analysis using 26918-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26918-1-AP (Integrin Beta 1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 26918-1-AP

  WB result of Integrin Beta 1/CD29 antibody (26918-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-Integrin Beta 1/CD29 transfected A549 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HT-1080 using 26918-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 26918-1-AP (Integrin beta-1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Integrin Beta 1/CD29 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse lung tissue, A549 cells, HT-1080 cells, rat lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26918-1-AP targets Integrin Beta 1/CD29 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25426

  Product name: Recombinant human Integrin beta-1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 752-798 aa of BC020057

  Sequence: KLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK

• Full Name: integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
• Calculated Molecular Weight: 88 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC020057
• Gene Symbol: Integrin beta 1
• Gene ID (NCBI): 3688
• ENSEMBL Gene ID: ENSG00000150093
• RRID: AB_2880685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05556
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Anti-ITGB1 antibody (Cat# 26918-1-AP) has 48 total citations published in journals including Nature Communications, Nature Metabolism, Cell Death & Disease, Cancer Letters, JCI Insight, FASEB Journal, Theranostics, and PLoS Pathogens. Research fields encompass fibrosis (hepatic, renal, pulmonary), cancer metastasis (breast, gastric, esophageal, lung), angiogenesis, tissue engineering, spinal cord injury repair, vascular biology, and inflammation. Primary applications are Western blot and immunohistochemistry in human, mouse, rat, and hamster models.

Automatically generated from the 48 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse		Mil Med Res; Single-cell transcriptomic dissection of the cellular and molecular events underlying the triclosan-induced liver fibrosis in mice; Authors - Yun-Meng Bai
rat	IP	Nat Metab; Early-activated extracellular matrix proteins shape the metabolic and spatial dynamics of the kidney fibrotic microenvironment.; Authors - Yuan Gui
human		Bioact Mater; Step-wise CAG@PLys@PDA-Cu2+ modification on micropatterned nanofibers for programmed endothelial healing; Authors - Bingcheng Yi
human	WB	Nat Commun; Regulation of local GTP availability controls RAC1 activity and cell invasion; Authors - Anna Bianchi-Smiraglia
rat,mouse	WB,IHC	Nat Commun; In situ osteogenic activation of mesenchymal stem cells by the blood clot biomimetic mechanical microenvironment; Authors - Wangxiao He
human	WB	J Adv Res; ST6GALNAC1-mediated sialylation in uterine endometrial epithelium facilitates the epithelium-embryo attachment; Authors - Xinyue Dong