Product Information
83514-5-PBS targets Integrin beta-5 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag29783 Product name: Recombinant human Integrin beta-5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-126 aa of BC006541 Sequence: GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTF Predict reactive species |
| Full Name | integrin, beta 5 |
| Calculated Molecular Weight | 88 kDa |
| GenBank Accession Number | BC006541 |
| Gene Symbol | Integrin beta 5 |
| Gene ID (NCBI) | 3693 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P18084 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
