Product Information
83649-4-PBS targets Involucrin in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag29585 Product name: Recombinant human Involucrin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 234-361 aa of NM_005547 Sequence: EVPSKQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQEGQLEHLEHQEG Predict reactive species |
| Full Name | involucrin |
| Calculated Molecular Weight | 68 kDa |
| GenBank Accession Number | NM_005547 |
| Gene Symbol | Involucrin |
| Gene ID (NCBI) | 3713 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P07476 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
