KCNA5 Polyclonal antibody, PBS Only

• 

  WB analysis using 21659-1-AP (same clone as 21659-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21659-1-AP (KCNA5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21659-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21659-1-AP (same clone as 21659-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21659-1-AP (KCNA5 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21659-1-PBS in a different storage buffer formulation.

KCNA5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21659-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21659-1-PBS targets KCNA5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16397

  Product name: Recombinant human KCNA5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-123 aa of BC099665

  Sequence: MEIALVPLENGGAMTVRGGDEARAGCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDADSGVRPLPPLPDPGVRPLPPLPEELPRPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQRVH

• Full Name: potassium voltage-gated channel, shaker-related subfamily, member 5
• Calculated Molecular Weight: 613 aa, 67 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC099665
• Gene Symbol: KCNA5
• Gene ID (NCBI): 3741
• RRID: AB_2878902
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22460
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.