KCNK12 Polyclonal antibody

• 

  WB analysis of mouse kidney using 29762-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 29762-1-AP (KCNK12 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

KCNK12 Polyclonal Antibody for WB, ELISA

Cat No. 29762-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, ELISA

Synonyms

KCNK12, THIK 2, THIK2

---

Tested Applications

• Positive WB detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29762-1-AP targets KCNK12 in WB, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31561

  Product name: Recombinant human KCNK12 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 302-430 aa of NM_022055

  Sequence: IKQVLNWMLRKLSCRCCARCCPAPGAPLARRNAITPGSRLRRRLAALGADPAARDSDAEGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGFSGGVGALGIMNNRLAETSASR

• Full Name: potassium channel, subfamily K, member 12
• Calculated Molecular Weight: 47KD
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: NM_022055
• Gene Symbol: KCNK12
• Gene ID (NCBI): 56660
• RRID: AB_3086156
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HB15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Potassium channel, subfamily K, member 12, also known as KCNK12, is a potassium channel containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. The calculated MW is 49 kDa, 29762-1-AP can detect a band around 49 kDa.