KDM4A Polyclonal antibody, PBS Only

KDM4A Polyclonal Antibody for WB, FC (Intra), IP, Indirect ELISA
Cat No. 29977-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), IP, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

29977-1-PBS targets KDM4A in WB, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31992

Product name: Recombinant human KDM4A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 584-720 aa of BC002558

Sequence: MFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDI

Predict reactive species
Full Name lysine (K)-specific demethylase 4A
Calculated Molecular Weight 1064 aa, 121 kDa
Observed Molecular Weight130-150 kDa
GenBank Accession NumberBC002558
Gene Symbol KDM4A
Gene ID (NCBI) 9682
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75164
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

KDM4A also named as JHDM3A, JMJD2, or KIAA0677 is a 1066 amino acid protein, which contains one JmjC domain, two Tudor domains and two PHD-type zinc fingers. KDM4A localizes in nucleus and belongs to the JHDM3 histone demethylase family. KDM4A is histone de-methylase that specifically demethylates Lys 9 and Lys 36 residues of Histone H3, thereby playing a central role in histone code. JMJD2A demethylation of lysine residues will generate formaldehyde and succinate. KDM4A also participates in transcriptional repression of ASCL2 and E2F-responsive promoters via the recruitment of histone deacetylases and NCOR1, respectively. JMJD2A is a ubiquitously expressed nuclear protein. KDM4A exists as two isoforms. The short isoform of KDM4A in which the N-terminal demethylase domains has been deleted. The molecular weight of short isoform is 55Da.

Loading...
||
New chat Able
正在加载,请稍候...