KDM4A Polyclonal antibody, PBS Only

• 

  WB analysis using 29977-1-AP (same clone as 29977-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29977-1-AP (KDM4A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29977-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 29977-1-AP (same clone as 29977-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 29977-1-AP (KDM4A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29977-1-PBS in a different storage buffer formulation.

• 

  IP experiment of MCF-7 using 29977-1-AP (same clone as 29977-1-PBS)

  IP result of anti-KDM4A (IP:29977-1-AP, 4ug; Detection:29977-1-AP 1:1500) with MCF-7 cells lysate 2120 ug. This data was developed using the same antibody clone with 29977-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A549 using 29977-1-AP (same clone as 29977-1-PBS)

  IP result of anti-KDM4A (IP:29977-1-AP, 4ug; Detection:29977-1-AP 1:1500) with A549 cells lysate 800 ug. This data was developed using the same antibody clone with 29977-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 29977-1-AP (same clone as 29977-1-PBS)

  1X10^6 A549 cells were intracellularly stained with 0.4 ug Anti-Human KDM4A (29977-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 29977-1-PBS in a different storage buffer formulation.

KDM4A Polyclonal Antibody for WB, FC (Intra), IP, Indirect ELISA

Cat No. 29977-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), IP, Indirect ELISA

Synonyms

---

Product Information

29977-1-PBS targets KDM4A in WB, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31992

  Product name: Recombinant human KDM4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 584-720 aa of BC002558

  Sequence: MFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDI

• Full Name: lysine (K)-specific demethylase 4A
• Calculated Molecular Weight: 1064 aa, 121 kDa
• Observed Molecular Weight: 130-150 kDa
• GenBank Accession Number: BC002558
• Gene Symbol: KDM4A
• Gene ID (NCBI): 9682
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75164
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KDM4A also named as JHDM3A, JMJD2, or KIAA0677 is a 1066 amino acid protein, which contains one JmjC domain, two Tudor domains and two PHD-type zinc fingers. KDM4A localizes in nucleus and belongs to the JHDM3 histone demethylase family. KDM4A is histone de-methylase that specifically demethylates Lys 9 and Lys 36 residues of Histone H3, thereby playing a central role in histone code. JMJD2A demethylation of lysine residues will generate formaldehyde and succinate. KDM4A also participates in transcriptional repression of ASCL2 and E2F-responsive promoters via the recruitment of histone deacetylases and NCOR1, respectively. JMJD2A is a ubiquitously expressed nuclear protein. KDM4A exists as two isoforms. The short isoform of KDM4A in which the N-terminal demethylase domains has been deleted. The molecular weight of short isoform is 55Da.