KDM4A Polyclonal antibody

KDM4A Polyclonal Antibody for WB, FC (Intra), IP, ELISA
Cat No. 29977-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), IP, CoIP, ELISA

JMJD2, JmjC domain-containing histone demethylation protein 3A, JHDM3A, EC:1.14.11.66, [histone H3]-trimethyl-L-lysine(9) demethylase 4A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, mouse lung tissue, MCF-7 cells, MDA-MB-231 cells, NCl-H1299 cells
Positive IP detected inMCF-7 cells, A549 cells
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29977-1-AP targets KDM4A in WB, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31992

Product name: Recombinant human KDM4A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 584-720 aa of BC002558

Sequence: MFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDI

Predict reactive species
Full Name lysine (K)-specific demethylase 4A
Calculated Molecular Weight 1064 aa, 121 kDa
Observed Molecular Weight130-150 kDa
GenBank Accession NumberBC002558
Gene Symbol KDM4A
Gene ID (NCBI) 9682
RRIDAB_2923625
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75164
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KDM4A also named as JHDM3A, JMJD2, or KIAA0677 is a 1066 amino acid protein, which contains one JmjC domain, two Tudor domains and two PHD-type zinc fingers. KDM4A localizes in nucleus and belongs to the JHDM3 histone demethylase family. KDM4A is histone de-methylase that specifically demethylates Lys 9 and Lys 36 residues of Histone H3, thereby playing a central role in histone code. JMJD2A demethylation of lysine residues will generate formaldehyde and succinate. KDM4A also participates in transcriptional repression of ASCL2 and E2F-responsive promoters via the recruitment of histone deacetylases and NCOR1, respectively. JMJD2A is a ubiquitously expressed nuclear protein. KDM4A exists as two isoforms. The short isoform of KDM4A in which the N-terminal demethylase domains has been deleted. The molecular weight of short isoform is 55Da.

Protocols

Product Specific Protocols
FC protocol for KDM4A antibody 29977-1-APDownload protocol
IP protocol for KDM4A antibody 29977-1-APDownload protocol
WB protocol for KDM4A antibody 29977-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Adv Sci (Weinh)

Targeting Intratumoral Copper Inhibits Tumor Progression via p62-Mediated EZH2 Degradation and Potentiates Anti-PD-1 Immunotherapy in Oral Squamous Cell Carcinoma

Authors - Xiaohu Lin

Biochem Pharmacol

SD49-7 attenuates cardiac hypertrophy by upregulation of S100B through KDM4A inhibition

Authors - Zhenzhen Zhang
humanWB

Cell Commun Signal

HPV11 targeting KDM4A regulates the polarization of macrophage M1 and promotes the development of nasal inverted papilloma

Authors - Liying Zheng
  • KO Validated
humanCoIP

J Environ Sci (China)

Carbon black induced pulmonary fibrosis through piR-713551/PIWIL4 targeting THBS2 signal pathway

Authors - Mengruo Wang
Loading...
||
New chat

Able

正在加载,请稍候...