KIAA1217 Polyclonal antibody

• 

  WB analysis using 24880-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24880-1-AP (KIAA1217 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse colon using 24880-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 24880-1-AP (KIAA1217 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 24880-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24880-1-AP (KIAA1217 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 24880-1-AP

  Rat colon lysates were subjected to SDS PAGE followed by western blot with 24880-1-AP (KIAA1217 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

KIAA1217 Polyclonal Antibody for WB, ELISA

Cat No. 24880-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

KIAA1217, Sickle tail protein homolog, SKT

---

Tested Applications

• Positive WB detected in: HEK-293 cells, rat colon tissue, mouse colon tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24880-1-AP targets KIAA1217 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19367

  Product name: Recombinant human KIAA1217 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 534-852 aa of BC018764

  Sequence: PAQNLPHVASSPAVPQEATSTLQMSQAPQSPQIPMNGSAMQSLFIEEIHSVSAKNRAVSIEKAEKKWEEKRQNLDHYNGKEFEKLLEEAQANIMKSIPNLEMPPATGPLPRGDAPVDKVELSEDSPNSEQDLEKLGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRKENITAKASSEDAGPSPQTRATKYPAEEPASAWTPSPPPVTTSSSKDEEEEEEEGDKIMAELQAFQKCSFMDVNSNSHAEPSRADSHVKDTRSGATVPPKEKKNLEFFHEDVRKSDVEYENGPQMEFQKGSSGAPQTSRMPVPMSAKNR

• Full Name: KIAA1217
• Calculated Molecular Weight: 1943 aa, 214 kDa
• Observed Molecular Weight: 100-110 kDa, 140-160 kDa, 210 kDa
• GenBank Accession Number: BC018764
• Gene Symbol: KIAA1217
• Gene ID (NCBI): 56243
• RRID: AB_2879775
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T5P2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KIAA1217, sickle tail protein homolog, is required for normal development of intervertebral disks. It promotes epithelial-mesenchymal transition and hepatocellular carcinoma metastasis by interacting with and activating STAT3, indicating its potential as a therapeutic target for curbing HCC metastasis (PMID: 35008530). It is also a novel candidate gene associated with isolated and syndromic vertebral malformations (PMID: 32369272). KIAA1217 has 9 alternatively spliced isoforms of 100-110 kDa, 140-160 kDa, 210 kDa.