KIR2DL3 Polyclonal antibody

• 

KIR2DL3 Polyclonal Antibody for ELISA

Cat No. 13455-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

CD158b, CD158B2, GL183, KIR 023GB, KIR K7b, KIR K7c, KIR2DL3, KIRCL23, MHC class I NK cell receptor, NKAT, NKAT 2, NKAT2, NKAT2A, NKAT2B, p58, p58 NK receptor CL 6

---

Product Information

13455-1-AP targets KIR2DL3 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4301

  Product name: Recombinant human KIR2DL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-247 aa of BC032422

  Sequence: WPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLHVL

• Full Name: killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3
• Calculated Molecular Weight: 341 aa, 38 kDa
• GenBank Accession Number: BC032422
• Gene Symbol: KIR2DL3
• Gene ID (NCBI): 3804
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43628
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.