KIR2DL4/CD158d Recombinant monoclonal antibody, PBS Only

• 

KIR2DL4/CD158d Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85135-3-PBS

Clone No.242235G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

KIR2DL4, CD158 antigen-like family member D, CD158D, G9P, Killer cell immunoglobulin-like receptor 2DL4

---

Product Information

85135-3-PBS targets KIR2DL4/CD158d in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1895

  Product name: Recombinant Human KIR2DL4 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-242 aa of BC041611

  Sequence: HVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH

• Full Name: killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4
• Calculated Molecular Weight: 377 aa, 42 kDa
• GenBank Accession Number: BC041611
• Gene Symbol: KIR2DL4
• Gene ID (NCBI): 3805
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99706
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.