Product Information
51099-1-AP targets KIRREL in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0639 Product name: Recombinant human KIRREL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 187-305 aa of BC109192 Sequence: INPTDLDIGRVFTCRSMNEAIPSGKETSIELDVHHPPTVTLSIEPQTVQEGERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVSTLVNVH Predict reactive species |
| Full Name | kin of IRRE like (Drosophila) |
| Calculated Molecular Weight | 757 aa, 84 kDa |
| GenBank Accession Number | BC109192 |
| Gene Symbol | KIRREL |
| Gene ID (NCBI) | 55243 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96J84 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
