Product Information
51099-1-AP targets KIRREL in ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0639 Product name: Recombinant human KIRREL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 187-305 aa of BC109192 Sequence: INPTDLDIGRVFTCRSMNEAIPSGKETSIELDVHHPPTVTLSIEPQTVQEGERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVSTLVNVH Predict reactive species |
Full Name | kin of IRRE like (Drosophila) |
Calculated Molecular Weight | 757 aa, 84 kDa |
GenBank Accession Number | BC109192 |
Gene Symbol | KIRREL |
Gene ID (NCBI) | 55243 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96J84 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |