KLHL12 Polyclonal antibody, PBS Only

• 

  WB analysis of PC-3 using 14883-1-AP (same clone as 14883-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 14883-1-AP (KLHL12 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14883-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 14883-1-AP (same clone as 14883-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 14883-1-AP (KLHL12 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14883-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14883-1-AP (same clone as 14883-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 14883-1-AP (KLHL12 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 14883-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14883-1-AP (same clone as 14883-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 14883-1-AP (KLHL12 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 14883-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 14883-1-AP (same clone as 14883-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using KLHL12 antibody (14883-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 14883-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

KLHL12 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 14883-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

C3IP1, CUL3 interacting protein 1, CUL3-interacting protein 1, DKIR, DKIR homolog

---

Product Information

14883-1-PBS targets KLHL12 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6658

  Product name: Recombinant human KLHL12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 217-568 aa of BC004175

  Sequence: NLLQYVRMPLLTPRYITDVIDAEPFIRCSLQCRDLVDEAKKFHLRPELRSQMQGPRTRARLGANEVLLVVGGFGSQQSPIDVVEKYDPKTQEWSFLPSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGVIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVVTSMGTQRCDAGVCVLREK

• Full Name: kelch-like 12 (Drosophila)
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 53-56 kDa, 63-67 kDa
• GenBank Accession Number: BC004175
• Gene Symbol: KLHL12
• Gene ID (NCBI): 59349
• RRID: AB_10644282
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53G59
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.