KLHL25 Polyclonal antibody, PBS Only

• 

  WB analysis using 27482-1-AP (same clone as 27482-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 27482-1-AP (KLHL25 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27482-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27482-1-AP (same clone as 27482-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27482-1-AP (KLHL25 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27482-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27482-1-AP (same clone as 27482-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27482-1-AP (KLHL25 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27482-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 27482-1-AP (same clone as 27482-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using KLHL25 antibody (27482-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 27482-1-PBS in a different storage buffer formulation.

KLHL25 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 27482-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

27482-1-PBS targets KLHL25 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25765

  Product name: Recombinant human KLHL25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 162-260 aa of BC028100

  Sequence: RRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPRKVHLPELLRSVRLALLPSDCLQEAVSSEALLMADE

• Full Name: kelch-like 25 (Drosophila)
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC028100
• Gene Symbol: KLHL25
• Gene ID (NCBI): 64410
• RRID: AB_2880883
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H0H3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.