KLK10 Recombinant monoclonal antibody, PBS Only

• 

KLK10 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85741-3-PBS

Clone No.242746G7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

EC:3.4.21.-, Kallikrein 10, Kallikrein-10, NES1, Normal epithelial cell-specific 1

---

Product Information

85741-3-PBS targets KLK10 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3132

  Product name: Recombinant Human KLK10 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 31-276 aa of NM_002776.4

  Sequence: AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN

• Full Name: kallikrein-related peptidase 10
• Calculated Molecular Weight: 30 kDa
• GenBank Accession Number: NM_002776.4
• Gene Symbol: KLK10
• Gene ID (NCBI): 5655
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43240
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.