Kallikrein 5 Polyclonal antibody

• 

  IHC staining of human skin using 10514-2-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 10514-2-AP (Kallikrein 5 antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skin using 10514-2-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 10514-2-AP (Kallikrein 5 antibody at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse testis using 10514-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10514-2-AP (Kallikrein 5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 10514-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10514-2-AP (Kallikrein 5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 10514-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 10514-2-AP (Kallikrein 5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 10514-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 10514-2-AP (Kallikrein 5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Kallikrein 5 Polyclonal Antibody for IHC, ELISA

Cat No. 10514-2-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF, IHC, ELISA

Synonyms

Kallikrein 5, Kallikrein like protein 2, kallikrein related peptidase 5, KLK L2, KLK5, KLKL2, SCTE, Stratum corneum tryptic enzyme

---

Tested Applications

• Positive IHC detected in: human skin tissue, mouse skin tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

10514-2-AP targets Kallikrein 5 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0799

  Product name: Recombinant human KLK5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 72-280 aa of BC008036

  Sequence: DCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCK

• Full Name: kallikrein-related peptidase 5
• Calculated Molecular Weight: 32 kDa
• GenBank Accession Number: BC008036
• Gene Symbol: KLK5
• Gene ID (NCBI): 25818
• RRID: AB_2134374
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y337
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KLK5(Kallikrein-5) is also named as SCTE and belongs to the kallikrein subfamily. This protein is predicted to be a secreted serine protease, and the enzyme is found to have proteolytic activity. In serum and ascites fluid, the protein is present in two forms, one at a relatively lower molecular mass (around 50 kDa), and another one around 150-180 kDa and native KLK5 is highly glycosylated or that it may interact with the gel filtration column, leading to delayed retention(PMID:12873991). The activation of the enzyme has been shown to require cleavage of an arginine residue (Arg66-Ile67), suggesting that a trypsin-like serine protease may be involved in this process(PMID:15713679).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Cancer Biomark; Salivary KLK5 and uPA are potential biomarkers for malignant transformation of OLK and OLP; Authors - Yingzhu Kang
human	WB,IF	J Dermatol Sci; Dichotomous effect of ultraviolet B on the expression of corneodesmosomal enzymes in human epidermal keratinocytes.; Authors - Nin Megumi M
human	WB,IHC	Cell Death Dis; Long noncoding RNA HEIH depletion depresses esophageal carcinoma cell progression by upregulating microRNA-185 and downregulating KLK5.; Authors - Bing Wang