KNTC1 Polyclonal antibody, PBS Only

• 

  WB analysis using 24694-1-AP (same clone as 24694-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24694-1-AP (KNTC1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24694-1-PBS in a different storage buffer formulation.

KNTC1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24694-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Kinetochore-associated protein 1, Kinetochore associated protein 1

---

Product Information

24694-1-PBS targets KNTC1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20268

  Product name: Recombinant human KNTC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1859-2209 aa of BC150278

  Sequence: DYSSRMLFVFATSTTTTLGMHQLTFAHRTRALQCLFYLADKETIESLFKKPIEEVKSYLRCITFLASFETLNIPITYELFCSSPKEGMIKGLWKNHSHESMAVRLVTELCLEYKIYDLQLWNGLLQKLLGFNMIPYLRKVLKAISSIHSLWQVPYFSKAWQRVIQIPLLSASCPLSPDQLSDCSESLIAVLECPVSGDLDLIGVARQYIQLELPAFALACLMLMPHSEKRHQQIKNFLGSCDPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQMLKMHAMNTNNITELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMFLSGLS

• Full Name: kinetochore associated 1
• Calculated Molecular Weight: 251 kDa
• Observed Molecular Weight: 210-230 kDa
• GenBank Accession Number: BC150278
• Gene Symbol: KNTC1
• Gene ID (NCBI): 9735
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50748
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KNTC1 is a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Northern blot analysis revealed low-to-moderate expression in all tissues tested, with highest expression in testis.