Cytokeratin 73 Polyclonal antibody, PBS Only

• 

  WB analysis using 27055-1-AP (same clone as 27055-1-PBS)

  rat skin tissue were subjected to SDS PAGE followed by western blot with 27055-1-AP (KRT73 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27055-1-PBS in a different storage buffer formulation.

Cytokeratin 73 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27055-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

KRT73, CK 73, CK-73, Cytokeratin-73, IRT6IRS3

---

Product Information

27055-1-PBS targets Cytokeratin 73 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25716

  Product name: Recombinant human KRT73 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-45 aa of BC109212

  Sequence: MSRQFTYKSGPAAKGGFSGCSAVLSGGSSSSYRAGGKGLSGGFSS

• Full Name: keratin 73
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC109212
• Gene Symbol: KRT73
• Gene ID (NCBI): 319101
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86Y46
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes a protein that is expressed in the inner root sheath of hair follicles. The type II keratins are clustered in a region of chromosome 12q13.