Kallikrein 2 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse pancreas using 10812-1-AP (same clone as 10812-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 10812-1-AP (Kallikrein 2 antibody at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10812-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10812-1-AP (same clone as 10812-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10812-1-AP (Kallikrein 2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 10812-1-PBS in a different storage buffer formulation.

Kallikrein 2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10812-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

10812-1-PBS targets Kallikrein 2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1077

  Product name: Recombinant human KLK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-261 aa of BC005196

  Sequence: MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

• Full Name: kallikrein-related peptidase 2
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 29 kda
• GenBank Accession Number: BC005196
• Gene Symbol: KLK2
• Gene ID (NCBI): 3817
• RRID: AB_2134232
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20151
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KLK2(Kallikrein-2) is also named as hGK-1 and belongs to the Kallikrein subfamily. It plays a role in prostate cancer susceptibility and this role may be realized at least in part by the induction of increases in its production. It also may mediate tumor growth and invasion by participating in proteolytic cascades. This protein has 4 isoforms produced by alternative splicing with the molecular weight of 29 kDa, 25 kDa, 18 kDa and 17 kDa.