LAIR1 Monoclonal antibody

• 

  WB analysis of THP-1 using 67220-1-Ig

  THP-1 cells were subjected to SDS PAGE followed by western blot with 67220-1-Ig (LAIR1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 67220-1-Ig

  HL-60 cells were subjected to SDS PAGE followed by western blot with 67220-1-Ig (LAIR1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of TF-1 using 67220-1-Ig

  TF-1 cells were subjected to SDS PAGE followed by western blot with 67220-1-Ig (LAIR1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 67220-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67220-1-Ig (LAIR1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 67220-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67220-1-Ig (LAIR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 67220-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using LAIR1 antibody (67220-1-Ig, Clone: 1A5D1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of human tonsillitis using 67220-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using LAIR1 antibody (67220-1-Ig, Clone: 1A5D1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of THP-1 using 67220-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using LAIR1 antibody (67220-1-Ig, Clone: 1A5D1 ) at dilution of 1:2000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002).

LAIR1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 67220-1-Ig

Clone No.1A5D1

Publications(1)

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

1A5D1, CD305, hLAIR1, LAIR 1, LAIR-1

---

Tested Applications

• Positive WB detected in: THP-1 cells, HL-60 cells, TF-1 cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

67220-1-Ig targets LAIR1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14459

  Product name: Recombinant human LAIR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 184-287 aa of BC027899

  Sequence: FCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH

• Full Name: leukocyte-associated immunoglobulin-like receptor 1
• Calculated Molecular Weight: 287 aa, 31 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC027899
• Gene Symbol: LAIR1
• Gene ID (NCBI): 3903
• RRID: AB_2882511
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6GTX8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1) is a transmembrane glycoprotein with a single immunoglobulin-like domain and a cytoplasmic tail containing two immune receptor tyrosine-based inhibitory motifs (PMID: 9285412). LAIR1 is expressed on the majority of human PBMCs, including NK, T, B, monocytes, and dendritic cells, as well as the majority of thymocytes (PMID: 10229813). It functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of NK cells, B cells and T cells. LAIR1 is a collagen receptor (PMID: 16754721). Tumor-expressed collagens can modulate immune cell function through the inhibitory collagen receptor LAIR1 (PMID: 21955987).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF	Cancer Med; Development and validation of a leukocyte-associated immunoglobulin-like receptor-1 prognostic signature for lower-grade gliomas.; Authors - Zhansheng Fang