LALBA Polyclonal antibody, PBS Only

• 

  WB analysis of human saliva using 24871-1-AP (same clone as 24871-1-PBS)

  human saliva were subjected to SDS PAGE followed by western blot with 24871-1-AP (LALBA antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24871-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24871-1-AP (same clone as 24871-1-PBS)

  human milk lysates were subjected to SDS PAGE followed by western blot with 24871-1-AP (LALBA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24871-1-PBS in a different storage buffer formulation.

LALBA Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24871-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24871-1-PBS targets LALBA in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21630

  Product name: Recombinant human LALBA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-142 aa of BC112316

  Sequence: QFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

• Full Name: lactalbumin, alpha-
• Calculated Molecular Weight: 142 aa, 16 kDa
• Observed Molecular Weight: 13-16 kDa
• GenBank Accession Number: BC112316
• Gene Symbol: LALBA
• Gene ID (NCBI): 3906
• RRID: AB_2879768
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P00709
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LALBA encodes alpha-lactalbumin which is secreted calcium metalloprotein, a principal protein of milk. As a monomer, LALBA strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. LALBA also could form a complex with the the beta 1,4-galactosyltransferase to produce the enzyme lactose synthase, participating in the biosynthesis of lactose. Moreover, these proteins enable lactose synthase to produce lactose by transfering galactose moieties to glucose. Studies have demonstrated that LALBA-null transgenic mice showed lacking lactose in the milk and inadequate for feeding the pups (PMID:26304038; PMID:12216958).