LAT Polyclonal antibody

• 

  WB analysis of Jurkat using 11326-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11326-1-AP (LAT Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 11326-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11326-1-AP (LAT antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 11326-1-AP

  IP result of anti-LAT (IP:11326-1-AP, 4ug; Detection:11326-1-AP 1:1000) with Jurkat cells lysate 3600ug.

• 

  IHC staining of human thymus using 11326-1-AP

  Immunohistochemical analysis of paraffin-embedded human thymus tissue slide using 11326-1-AP (LAT Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of Jurkat using 11326-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using LAT antibody (11326-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

LAT Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11326-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

36 kDa phosphotyrosine adapter protein, LAT1, Linker for activation of T-cells family member 1, p36 38, p36-38

---

Tested Applications

• Positive WB detected in: Jurkat cells, mouse thymus
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human thymus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 9 publications below
• IHC: See 2 publications below

Product Information

11326-1-AP targets LAT in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1868

  Product name: Recombinant human LAT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-233 aa of BC011563

  Sequence: MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN

• Full Name: linker for activation of T cells
• Calculated Molecular Weight: 262 aa, 28 kDa
• Observed Molecular Weight: 36-38 kDa
• GenBank Accession Number: BC011563
• Gene Symbol: LAT
• Gene ID (NCBI): 27040
• RRID: AB_10695624
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43561
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LAT is a membrane-localized adaptor protein which is primarily concentrated in microdomains by palmitoylation. LAT plays a central role in T-cell activation by nucleating signaling complexes that are critical for the propagation of T-cell signals from the plasma membrane to the cellular interior. In addition to being a positive regulator of T cell signaling, LAT also recruits several negative regulatory proteins, including kinases, phosphatases, and ubiquitin ligases, which ultimately leads to signal termination. LAT is subject to ubiquitylation, and ubiquitin-resistant mutants of LAT display enhanced signaling.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Pharmacol; HIF1α/VEGF Feedback Loop Contributes to 5-Fluorouracil Resistance.; Authors - Bin Shi
human	IHC	Sci Rep; A ceRNA-associated risk model predicts the poor prognosis for head and neck squamous cell carcinoma patients.; Authors - Yuzi Xu
human	IHC	Hepatol Int; Upregulation of CD147 protects hepatocellular carcinoma cell from apoptosis through glycolytic switch via HIF-1 and MCT-4 under hypoxia.; Authors - Xia Ke
human	WB	Cell Immunol; Cbl-b inhibition promotes less differentiated phenotypes of T cells with enhanced cytokine production; Authors - Junfan Wang
mouse	WB	Nat Commun; Cell volume controlled by LRRC8A-formed volume-regulated anion channels fine-tunes T cell activation and function; Authors - Yuman Wang
mouse	WB	Nat Commun; Sterically chained amino acid-rich water-soluble carbon quantum dots as a robust tumor-targeted drug delivery platform; Authors - Wenjing Xie