Tested Applications
Positive WB detected in | HT-29 cells, human saliva |
Positive IHC detected in | human colon cancer tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A431 cells |
Positive FC (Intra) detected in | A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 33 publications below |
IHC | See 12 publications below |
IF | See 8 publications below |
Product Information
26991-1-AP targets Lipocalin-2/NGAL in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25715 Product name: Recombinant human LCN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Sequence: MQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG Predict reactive species |
Full Name | lipocalin 2 |
Observed Molecular Weight | 25 kDa |
Gene Symbol | NGAL/LCN2 |
Gene ID (NCBI) | 3934 |
RRID | AB_2880715 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P80188 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Lipocalin-2 (LCN-2) is a adipocytokine also referred to as neutrophil gelatinase-associated lipocalin (NGAL). Lipocalin-2 is a circulatory protein responsible for the transportation of small and hydrophobic molecules to target organs. Lipocalin-2 is used as a biomarker for acute and chronic renal injury. It is present in a large variety of cells including neutrophil, hepatocytes, lung, bone marrow, adipose tissue, macrophages, thymus, non-neoplastic breast duct, prostate, and renal cells. Different functions have been associated with Lipocalin-2, including antibacterial, anti-inflammatory, and protection against cell and tissue stress (PMID:34463264).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Lipocalin-2/NGAL antibody 26991-1-AP | Download protocol |
IHC protocol for Lipocalin-2/NGAL antibody 26991-1-AP | Download protocol |
IF protocol for Lipocalin-2/NGAL antibody 26991-1-AP | Download protocol |
FC protocol for Lipocalin-2/NGAL antibody 26991-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Neurol Neurosurg Psychiatry Molecules of senescent glial cells differentiate Alzheimer's disease from ageing | ||
Cell Chem Biol 3D two-photon brain imaging reveals dihydroartemisinin exerts antiepileptic effects by modulating iron homeostasis. | ||
Oxid Med Cell Longev Sirtuin 1 Induces Choroidal Neovascularization and Triggers Age-Related Macular Degeneration by Promoting LCN2 through SOX9 Deacetylation.
| ||
Gastric Cancer Lipocalin-2 negatively regulates epithelial-mesenchymal transition through matrix metalloprotease-2 downregulation in gastric cancer.
| ||
Biochim Biophys Acta Mol Basis Dis Lipocalin-2-mediated intestinal epithelial cells pyroptosis via NF-κB/NLRP3/GSDMD signaling axis adversely affects inflammation in colitis | ||
iScience Mutational burden of XPNPEP3 leads to defects in mitochondrial complex I and cilia in NPHPL1 |