Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

LDHA Monoclonal antibody

LDHA Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66287-1-Ig
Clone No. 2E2G6
Publications (43)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

LDH-A, LDH A, lactate dehydrogenase A, EC:1.1.1.27, Cell proliferation-inducing gene 19 protein

Formulation:  PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for LDHA in ?

Tested Applications

Positive WB detected inpig liver tissue, pig skeletal muscle tissue, A431 cells, rat skeletal muscle, mouse skeletal muscle
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66287-1-Ig targets LDHA in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21417

Product name: Recombinant human LDHA protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 283-332 aa of BC067223

Sequence: IKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF

Predict reactive species
Full Name lactate dehydrogenase A
Calculated Molecular Weight 332 aa, 37 kDa
Observed Molecular Weight 32-40 kDa
GenBank Accession NumberBC067223
Gene Symbol LDHA
Gene ID (NCBI) 3939
RRIDAB_2881670
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP00338
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LDHA, also named as LDH-M and NY-REN-59, is an enzyme which catalyzes the inter-conversion of pyruvate and L-lactate with concomitant inter-conversion of NADH and NAD+. LDHA is found in most somatic tissues, though predominantly in muscle tissue and tumours, and belongs to the lactate dehydrogenase family. It has long been known that many human cancers have higher LDHA levels compared to normal tissues. It has also been shown that LDHA plays an important role in the development, invasion and metastasis of malignancies. Mutations in LDHA have been linked to exertional myoglobinuria. LDHA has some isoforms with MW 26-40 kDa.

Publications

What published studies show

66287-1-Ig is a polyclonal antibody targeting LDHA (Lactate Dehydrogenase A), with 43 total citations. Citations appear in journals including Cell Metabolism, Science Advances, ACS Nano, Developmental Cell, Oncogene, Cell Reports, iScience, Frontiers in Oncology, and others with impact factors ranging from 2.1 to 37. Research fields encompass glycolysis, lactate metabolism, cancer biology (breast, lung, pancreatic, colorectal, liver), immune response, mitochondrial function, histone lactylation, cardiovascular disease, and neurodegeneration.

SpeciesApplicationTitle
mouseWB

Cell Metab

Augmentation of scleral glycolysis promotes myopia through histone lactylation

Authors - Xiaolei Lin
mouseWB

Cell Metab

Dual impacts of serine/glycine-free diet in enhancing antitumor immunity and promoting evasion via PD-L1 lactylation

Authors - Huan Tong

Drug Resist Updat

Lactate-driven H3K18 lactylation promotes cisplatin resistance in bladder cancer via HNRNPF-Parkin mediated mitophagy.

Authors - Henchui Zhang
humanWB,IF

ACS Nano

Copper-Oxamate Coordination Polymers Reverse Cuproptosis Resistance in Nonsmall Cell Lung Cancer via Glycolysis Reprogramming.

Authors - Hui Liu
mouseWB

J Nanobiotechnology

Lacc1-engineered extracellular vesicles reprogram mitochondrial metabolism to alleviate inflammation and cartilage degeneration in TMJ osteoarthritis

Authors - Xiaofeng Hu
mouseIF

Sci Adv

Chronic stress hinders sensory axon regeneration via impairing mitochondrial cristae and OXPHOS

Authors - Yu Ruan
Loading...
||
New chat

Able™

正在加载,请稍候...