LEF1 Polyclonal antibody

LEF1 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 28540-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF/ICC, ELISA

TCF1ALPHA, TCF1 alpha, T cell-specific transcription factor 1-alpha, Lymphoid enhancer-binding factor 1, LEF-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCOLO 320 cells, SW480 cells, Jurkat cells
Positive IF/ICC detected inHepG2 cells, A549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 3 publications below

Product Information

28540-1-AP targets LEF1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29841

Product name: Recombinant human LEF1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-98 aa of BC050632

Sequence: MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPD

Predict reactive species
Full Name lymphoid enhancer-binding factor 1
Calculated Molecular Weight 37 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC050632
Gene Symbol LEF1
Gene ID (NCBI) 51176
ENSEMBL Gene IDENSG00000138795
RRIDAB_2881166
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UJU2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lymphoid enhancer-binding factor 1(LEF1) belongs to a family of regulatory protein share homology with high mobility group protein-1, and it's a nuclear protein exprssed in pre-B and T cells. LEF1 has a role in the Wnt signaling pathway and hair cell differentiation and follicle morphogenesis. LEF1 exists as seven isoforms and we detects three isoforms with MW 44 kDa, 36 kDa and 23 kDa. Together with CTNNB1 and EP300, LEF1 activates transcription of target genes. Isoform 5 transcriptionally activates the fibronectin promoter, binds to and represses transcription from the E-cadherin promoter in a CTNNB1-independent manner, and is involved in reducing cellular aggregation and increasing cell migration of pancreatic cancer cells. Isoform 1 transcriptionally activates MYC and CCND1 expression and enhances proliferation of pancreatic tumor cells. MECs can give rise to seven cell types of the SAE and SMGs following severe airway injury. MECs progressively adopted a basal cell phenotype on the SAE and established lasting progenitors capable of further regeneration following reinjury. MECs activate Wnt-regulated transcription factors (Lef-1/TCF7) following injury and Lef-1 induction in cultured MECs promoted transition to a basal cell phenotype. Surprisingly, dose-dependent MEC conditional activation of Lef-1in vivopromoted self-limited airway regeneration in the absence of injury. Thus, modulating the Lef-1 transcriptional program in MEC-derived progenitors may have regenerative medicine applications for lung diseases. (https://doi.org/10.1016/j.stem.2018.03.017) The phosphorylation may affects LEF1 protein's theoretical molecular weight when tested.40-70 kD bands have also been reported (PMID:22261717;17063141 ).

Protocols

Product Specific Protocols
IF protocol for LEF1 antibody 28540-1-APDownload protocol
WB protocol for LEF1 antibody 28540-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Clin Transl Med

Long noncoding RNA LINC01606 protects colon cancer cells from ferroptotic cell death and promotes stemness by SCD1-Wnt/β-catenin-TFE3 feedback loop signalling.

Authors - Yajun Luo
ratWB

Int J Neurosci

The dynamic expression of canonical Wnt/β-catenin signalling pathway in the pathologic process of experimental autoimmune neuritis.

Authors - Yin Liu
humanWB

Cancer Med

Palladin promotes cancer stem cell-like properties in lung cancer by activating Wnt/Β-Catenin signaling

Authors - Xiong Shu

Clin Exp Immunol

Dissecting T cell heterogeneity in esophageal squamous-cell carcinoma reveal the potential role of LAIR2 in anti-tumor immunity

Authors - Ping Wang
Loading...
||
New chat Able
正在加载,请稍候...