LIAT1 Polyclonal antibody

• 

  WB analysis using 31796-1-AP

  HEK-293T cells, HeLa cells, mouse kidney tissue, mouse liver tissue, mouse lung tissue, mouse spleen tissue lysates were subjected to SDS PAGE followed by western blot with 31796-1-AP (LIAT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 31796-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 31796-1-AP (LIAT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 31796-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using LIAT1 antibody (31796-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

LIAT1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 31796-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

C17orf97, Ligand of ATE1 protein, Protein LIAT1

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, mouse kidney tissue, mouse liver tissue, mouse lung tissue, mouse spleen tissue
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31796-1-AP targets LIAT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37082

  Product name: Recombinant human C17orf97 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-200 aa of BC141806

  Sequence: GDDKHLSQSLKSQPLSSSFHDILSPCKERGPKPEHRQSKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCL

• Full Name: chromosome 17 open reading frame 97
• Observed Molecular Weight: 20-70 kDa
• GenBank Accession Number: BC141806
• Gene Symbol: C17orf97
• Gene ID (NCBI): 400566
• RRID: AB_3670116
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6ZQX7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Liat1 (Ligand of Ate1) is a protein of unknown function that was originally discovered through its interaction with arginyl tRNA protein transferase 1 (Ate1), a component of the Arg/N-degron pathway of protein degradation.Liat1 participates in Liquid-liquid phase separation (LLPS), a process which enables the temporal and spatial regulation of important cellular processes such as RNA metbolism, genome organization, DNA repair, and transcription regulation. Liat1 interacts with itself, which means Liat1 can assemble into different species in nucleus or cytosol. Our WB is consistent with Arva A et al (PMID: 33443146).