• Featured Product
  • KD/KO Validated

LIF Polyclonal antibody

LIF Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 26757-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Leukemia inhibitory factor, Differentiation-stimulating factor, Melanoma-derived LPL inhibitor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, U-87 MG cells
Positive IHC detected inhuman lung cancer tissue, mouse embryo tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse embryo tissue
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26757-1-AP targets LIF in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25076

Product name: Recombinant human LIF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 27-202 aa of BC093733

Sequence: ITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Predict reactive species
Full Name leukemia inhibitory factor (cholinergic differentiation factor)
Calculated Molecular Weight 202 aa, 22 kDa
Observed Molecular Weight 22 kDa, 32 kDa
GenBank Accession NumberBC093733
Gene Symbol LIF
Gene ID (NCBI) 3976
RRIDAB_2880624
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15018
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LIF is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. LIF is a glycoprotein with variable molecular weight (38-67 kDa) due to differential glycosylation. (PMID: 8262236, PMID: 35204717)

Protocols

Product Specific Protocols
IF protocol for LIF antibody 26757-1-APDownload protocol
IHC protocol for LIF antibody 26757-1-APDownload protocol
WB protocol for LIF antibody 26757-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cell Stem Cell

LIF signaling regulates outer radial glial to interneuron fate during human cortical development

Authors - Madeline G Andrews
mouseWB,IHC

Toxicology

Toxicity mechanism of peri-implantation pesticide beta-cypermethrin exposure on endometrial remodeling in early pregnant mice

Authors - Yong-Jiang Zhou
humanWB

Hum Reprod

The depot GnRH agonist protocol improves the live birth rate per fresh embryo transfer cycle, but not the cumulative live birth rate in normal responders: a randomized controlled trial and molecular mechanism study.

Authors - Bei Xu
humanIHC

Int J Cancer

Leukemia inhibitory factor is a novel biomarker to predict lymph node and distant metastasis in pancreatic cancer.

Authors - Wenna Jiang
humanWB

Reprod Biol Endocrinol

Expression and significance of miR-30d-5p and SOCS1 in patients with recurrent implantation failure during implantation window

Authors - Yuhao Zhao
mouseIHC

Reproduction

Consistency and synchronization of AMPK-glycogen in endometrial epithelial cells are critical to the embryo implantation.

Authors - Li Nie
Loading...
||
New chat Able
正在加载,请稍候...