Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells, Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
26644-1-AP targets LIN54 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24507 Product name: Recombinant human LIN54 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 555-631 aa of BC109278 Sequence: LADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAER Predict reactive species |
| Full Name | lin-54 homolog (C. elegans) |
| Calculated Molecular Weight | 749 aa, 79 kDa |
| Observed Molecular Weight | 79 kDa, 100 kDa |
| GenBank Accession Number | BC109278 |
| Gene Symbol | LIN54 |
| Gene ID (NCBI) | 132660 |
| RRID | AB_3669558 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6MZP7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LIN54 is a component of the LINC/DREAM complex, an important regulator of cell cycle genes (PMID: 17671431; 19725879). The complex binds to more than 800 promoters in G0 phase and is required for repression of E2F target genes (PMID:17531812). In S phase, the complex binds to the promoters of G2/M genes whose products are required for mitosis and plays an important role in their cell cycle dependent activation (PMID:17671431). LIN54 has a DNA binding region (CXC-hinge-CXC, CHC domain), which consists of two cysteine-rich (CXC) domains separated by a short spacer. It has been reported that the CHC domain functions as a DNA binding domain, and conserved cysteine residues in two CXC domains are essential for DNA binding (PMID: 22895175). The calculated molecular weight of LIN54 is 79 kDa and an apparent molecular mass of 100-110 kDa has been reported (PMID: 17531812; 28920576; 17671431).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for LIN54 antibody 26644-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
