LMAN2L Polyclonal antibody, PBS Only

• 

  WB analysis of N2a cells using 17877-1-AP (same clone as 17877-1-PBS)

  WB result of VIPL/LMAN2L antibody (17877-1-AP) detected with N2a cells transfected with plasmid and siRNA-VIPL.(Data from Dr. Keiji Uchiyama, Tokushima University). This data was developed using the same antibody clone with 17877-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 17877-1-AP (same clone as 17877-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 17877-1-AP (LMAN2L Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 17877-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 17877-1-AP (same clone as 17877-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 17877-1-AP (LMAN2L Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 17877-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LMAN2L Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17877-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

17877-1-PBS targets LMAN2L in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11737

  Product name: Recombinant human LMAN2L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-315 aa of BC067265

  Sequence: MAATLGPLGSWQQWRRCLSARDGSRMLLLLLLLGSGQGPQQVGAGQTFEYLKREHSLSKPYQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLPPLSGLALF

• Full Name: lectin, mannose-binding 2-like
• Calculated Molecular Weight: 348 aa, 40 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC067265
• Gene Symbol: LMAN2L
• Gene ID (NCBI): 81562
• RRID: AB_2878459
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H0V9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.