LMTK2 Polyclonal antibody, PBS Only

• 

  WB analysis using 31540-1-AP (same clone as 31540-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31540-1-AP (LMTK2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31540-1-PBS in a different storage buffer formulation.

LMTK2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31540-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31540-1-PBS targets LMTK2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35620

  Product name: Recombinant human LMTK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1371-1503 aa of BC131504

  Sequence: TPTKELGPCGGEACGPDLSGPAPASGSPYLSRCINSESSTDEEGGGFEWDDDFSPDPFMSKTTSNLLSSKPSLQTSKYFSPPPPARSTEQSWPHSAPYSRFSISPANIASFSLTHLTDSDIEQGGSSEDGEKD

• Full Name: lemur tyrosine kinase 2
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: BC131504
• Gene Symbol: LMTK2
• Gene ID (NCBI): 22853
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8IWU2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Lemur tyrosine kinase 2 (LMTK2) is a transmembrane protein with serine and threonine but not tyrosine kinase activity.