LOC286135 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 21958-1-AP (same clone as 21958-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21958-1-AP (LOC286135 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21958-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 21958-1-AP (same clone as 21958-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21958-1-AP (LOC286135 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 21958-1-AP (same clone as 21958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 21958-1-AP (LOC286135 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 21958-1-AP (same clone as 21958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 21958-1-AP (LOC286135 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 21958-1-AP (same clone as 21958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 21958-1-AP (LOC286135 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 21958-1-AP (same clone as 21958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 21958-1-AP (LOC286135 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21958-1-PBS in a different storage buffer formulation.

LOC286135 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21958-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

21958-1-PBS targets LOC286135 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16644

  Product name: Recombinant human LOC286135 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-138 aa of BC126344

  Sequence: MMQPHPQLLPLQMLLGQFHLGLSHQLPPNVTGPQMDLQTPMPNHLPATFPGQPTGHMITRKPMSLHDNLEKPTDARLLNLIHHASQGSRKKYPEIQTEKSGNWMGFRALGMEPSHSFTQLQSKTCSSEAGLLHRDLSK

• Full Name: hypothetical LOC286135
• Calculated Molecular Weight: 138 aa, 15 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC126344
• Gene Symbol: LOC286135
• Gene ID (NCBI): 286135
• RRID: AB_11042462
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.