Product Information
10491-1-AP targets LOC84740 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0759 Product name: Recombinant human LOC84740 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-55 aa of BC004397 Sequence: MAKDTASLFIPLCGCSNSKSGTTGQMNVGTCRYGSLALRQLVWGLPPGASWPHLR Predict reactive species |
| Full Name | hypothetical LOC84740 |
| Calculated Molecular Weight | 22 kDa, 36 kDa |
| GenBank Accession Number | BC004397 |
| Gene Symbol | LOC84740 |
| Gene ID (NCBI) | 84740 |
| RRID | AB_513753 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
The LOC84740 Polyclonal antibody (Cat# 10491-1-AP) has 10 citations across journals including Signal Transduction and Targeted Therapy, Autophagy, Journal of Orthopaedic Translation, European Journal of Medicinal Chemistry, CNS Neuroscience & Therapeutics, Cell & Molecular Life Sciences, Frontiers in Molecular Neuroscience, American Journal of Physiology, Frontiers in Oncology, and Translational Cancer Research. Research fields span osteoporosis, ferroptosis, cartilage/intervertebral disc degeneration, colorectal cancer, epilepsy, glioma, NAFLD, and mitochondrial biology.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Targeting N(1)-methyladenosine modification in osteoblasts through tRNA methyltransferase 10C reverses mitochondrial dysfunction and ameliorates osteoporosis. | ||
Autophagy Mechanical stress-mediated ferritinophagy aggravates cartilage endplate degeneration via a PIEZO1-NCOA4-ZBP1 axis. | ||
J Orthop Translat HIF-2α/TFR1 mediated iron homeostasis disruption aggravates cartilage endplate degeneration through ferroptotic damage and mtDNA release: A new mechanism of intervertebral disc degeneration | ||
Eur J Med Chem Discovery of potent TNIK inhibitors containing a 1H-pyrrolo[2,3-b]pyridine scaffold as promising therapeutics for colorectal cancer. | ||
CNS Neurosci Ther STK24 modulates excitatory synaptic transmission in epileptic hippocampal neurons. | ||
Cell Mol Life Sci Melatonin attenuates intervertebral disc degeneration by restoring mitochondrial homeostasis through PGC-1α signaling pathway |
Reviews
What customers say
One customer rated this antibody 4 out of 5 stars for flow cytometry, noting that it "worked well as expected." The reviewer did not provide additional details on dilution, tissue/cell type, or lot number. Overall, the feedback is positive but brief, indicating satisfactory performance without highlighting any specific issues or standout features.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Amelia (Verified Customer) (06-20-2022) | The antibody worked well as expected.
|
