LPXN Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83657-5-RR (same clone as 83657-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83657-5-RR (LPXN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83657-5-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 83657-5-RR (same clone as 83657-5-PBS)

  WB result of LPXN antibody (83657-5-RR; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-LPXN transfected PC-3 cells. This data was developed using the same antibody clone with 83657-5-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 83657-5-RR (same clone as 83657-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using LPXN antibody (83657-5-RR, Clone: 240483G10 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83657-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83657-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83657-5-RR against Human LPXN were performed. The affinity constant is 0.187 nM.

• Featured Product
• KD/KO Validated

LPXN Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 83657-5-PBS

Clone No.240483G10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

240483G10, LDLP, LDPL

---

Product Information

83657-5-PBS targets LPXN in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34956

  Product name: Recombinant human LPXN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 5-132 aa of BC019035

  Sequence: DALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSML

• Full Name: leupaxin
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC019035
• Gene Symbol: LPXN
• Gene ID (NCBI): 9404
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O60711
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LPXN, also known as Leupaxin, LDPL, belongs to the paxillin family. LPXN Contributes to the regulation of cell adhesion, spreading, and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events (PMID: 20543562). LPXN has four leucine-rich LD-motifs in the N-terminus and four LIM domains in the C-terminus. It may function in cell type-specific signaling by associating with PYK2, a member of the focal adhesion kinase family (PMID: 9565592). Studies in breast cancer implicate LPXN is involved in the regulation of ER action as a co-factor (PMID: 25955236). LPXN is expressed in prostate cancer cells and its expression intensity is directly linked to PCa progression (PMID: 18451096).