LRRC8C Monoclonal antibody, PBS Only

• 

  WB analysis of U2OS using 68323-1-Ig (same clone as 68323-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 68323-1-Ig (LRRC8C antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68323-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68323-1-Ig (same clone as 68323-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68323-1-Ig (LRRC8C antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68323-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 68323-1-Ig (same clone as 68323-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using LRRC8C antibody (68323-1-Ig, Clone: 4A6A4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 68323-1-PBS in a different storage buffer formulation.

LRRC8C Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68323-1-PBS

Clone No.4A6A4

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

AD158, DKFZp586J1119, FAD158, LRRC8C

---

Product Information

68323-1-PBS targets LRRC8C in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17001

  Product name: Recombinant human LRRC8C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 618-803 aa of BC113973

  Sequence: DLKENNLKSIEEIVSFQHLRKLTVLKLWHNSITYIPEHIKKLTSLERLSFSHNKIEVLPSHLFLCNKIRYLDLSYNDIRFIPPEIGVLQSLQYFSITCNKVESLPDELYFCKKLKTLKIGKNSLSVLSPKIGNLLFLSYLDVKGNHFEILPPELGDCRALKRAGLVVEDALFETLPSDVREQMKTE

• Full Name: leucine rich repeat containing 8 family, member C
• Calculated Molecular Weight: 803 aa, 92 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC113973
• Gene Symbol: LRRC8C
• Gene ID (NCBI): 84230
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TDW0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LRRC8C (Leucine-rich repeat-containing protein 8C), also known as AD158, is a non-essential component of the volume-regulated anion channel (VRAC, also known as VSOAC channel), which is required to maintain a constant cell volume in response to extracellular or intracellular permeability changes. The VRAC channel conducts iodide better than chloride and can also conduct organic osmolytes like taurine. The VRAC channel also mediates transport of immunoreactive cyclic dinucleotide GMP-AMP (2'-3'-cGAMP), an immune messenger produced in response to DNA virus in the cytosol (PMID:24790029; 26824658; 28193731).