Product Information
12040-1-AP targets LRRFIP1 in ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2673 Product name: Recombinant human LRRFIP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC010662 Sequence: MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ Predict reactive species |
Full Name | leucine rich repeat (in FLII) interacting protein 1 |
Calculated Molecular Weight | 12 kDa |
GenBank Accession Number | BC010662 |
Gene Symbol | LRRFIP1 |
Gene ID (NCBI) | 9208 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q32MZ4 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |