Tested Applications
| Positive WB detected in | HEK-293 cells, K-562 cells, human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32074-1-AP targets LSM2 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34865 Product name: Recombinant human LSM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 40-95 aa of BC009192 Sequence: LTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ Predict reactive species |
| Full Name | LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC009192 |
| Gene Symbol | LSM2 |
| Gene ID (NCBI) | 57819 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9Y333 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing (PMID:15075370). Lsm2-Lsm8 (Lsm stands for Like Sm), binds and stabilizes the 3′ end of the spliceosomal U6 snRNA Lsm proteins facilitate the annealing of U6 snRNA with U4 snRNA in vitro and interact with the U4/U6 annealing factor Prp24, suggesting that Lsm proteins function in U4/U6 snRNP formation in vivo (PMID:15485930, 17251193).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for LSM2 antibody 32074-1-AP | Download protocol |
| WB protocol for LSM2 antibody 32074-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



