LSM7 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 18941-1-AP (same clone as 18941-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 18941-1-AP (LSM7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18941-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 18941-1-AP (same clone as 18941-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 18941-1-AP (LSM7 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18941-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 18941-1-AP (same clone as 18941-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 18941-1-AP (LSM7 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18941-1-PBS in a different storage buffer formulation.

LSM7 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 18941-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

18941-1-PBS targets LSM7 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13498

  Product name: Recombinant human LSM7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-103 aa of BC018621

  Sequence: MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA

• Full Name: LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae)
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC018621
• Gene Symbol: LSM7
• Gene ID (NCBI): 51690
• RRID: AB_10596483
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UK45
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.