LSS Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 18693-1-AP (same clone as 18693-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 18693-1-AP (LSS antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18693-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 18693-1-AP (same clone as 18693-1-PBS)

  IP result of anti-LSS (IP:18693-1-AP, 4ug; Detection:18693-1-AP 1:500) with HeLa cells lysate 1880 ug. This data was developed using the same antibody clone with 18693-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 18693-1-AP (same clone as 18693-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18693-1-AP (LSS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18693-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 18693-1-AP (same clone as 18693-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18693-1-AP (LSS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18693-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 18693-1-AP (same clone as 18693-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HepG2 cells using 18693-1-AP (LSS antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 18693-1-PBS in a different storage buffer formulation.

LSS Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 18693-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

18693-1-PBS targets LSS in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6955

  Product name: Recombinant human LSS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 382-732 aa of BC035638

  Sequence: NGSQIWDTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRLSQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMGQTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRYVQSAQSQIHNTCWAMMGLMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFSQLYPERALAGHP

• Full Name: lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)
• Calculated Molecular Weight: 732 aa, 83 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC035638
• Gene Symbol: LSS
• Gene ID (NCBI): 4047
• RRID: AB_2138608
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48449
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LSS, also named as OSC, is lanosterol synthase which catalyzes the cyclization of (S)-2,3 oxidosqualene to lanosterol, a reaction that forms the sterol nucleus. LSS gene has three isoforms with MW 74 kDa and 82-85 kDa. This antibody can recognize all these three isoforms.