LY96/MD2 Polyclonal antibody

• 

  WB analysis using 11784-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11784-1-AP (LY96/MD2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 11784-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11784-1-AP (LY96/MD2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 11784-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11784-1-AP (LY96/MD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

LY96/MD2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11784-1-AP

Publications(15)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

LY96, MD2, ESOP 1, ESOP1, ESOP-1

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 9 publications below
• IHC: See 3 publications below
• IF: See 2 publications below
• IP: See 1 publications below
• CoIP: See 2 publications below

Product Information

11784-1-AP targets LY96/MD2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2447

  Product name: Recombinant human LY96 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-160 aa of BC020690

  Sequence: MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

• Full Name: lymphocyte antigen 96
• Calculated Molecular Weight: 160 aa, 18 kDa
• Observed Molecular Weight: 20-26 kDa
• GenBank Accession Number: BC020690
• Gene Symbol: MD2
• Gene ID (NCBI): 23643
• RRID: AB_2138089
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6Y9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LY96, also named as ESOP1 or MD 2, is a small secreted glycoprotein that can bind to both the hydrophobic portion of LPS and to the extracellular domain of TLR4. The interaction between MD-2 and LPS bridges the two TLR4 molecules and induces the dimerization of LPS-MD-2-TLR4, which forms the structural basis for biological functions of TLR4/MD-2 complex. Due to its essential role in mediating the interaction between LPS and TLR4, MD-2 has been extensively explored as a therapeutic target for treatment of inflammatory disorders.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; MD2 Is a Potential Biomarker Associated with Immune Cell Infiltration in Gliomas.; Authors - Mengya Zhao
mouse	WB	J Pharmacol Exp Ther; The protective effect of Amitriptyline on experimental colitis through inhibiting TLR4/MD2 signaling pathway; Authors - Chengcheng Zeng
mouse	WB	J Cardiovasc Transl Res; Macrophage CD36 and TLR4 Cooperation Promotes Foam Cell Formation and VSMC Migration and Proliferation Under Circadian Oscillations.; Authors - Zhen Sun
rat		Molecules; Sal B Alleviates Myocardial Ischemic Injury by Inhibiting TLR4 and the Priming Phase of NLRP3 Inflammasome.; Authors - Yang Hu
human	WB	Oncol Rep; Curcumin inhibits cell proliferation and migration in NSCLC through a synergistic effect on the TLR4/MyD88 and EGFR pathways.; Authors - Lanfeng Zhang
human	WB	J Reprod Immunol; The NLRP3 activation-related signature predicts the diagnosis and indicates immune characteristics in endometriosis; Authors - Weihua Nong