LYRM5 Polyclonal antibody

• 

  IP experiment of mouse heart using 31548-1-AP

  IP result of anti-LYRM5 (IP:31548-1-AP, 4ug; Detection:31548-1-AP 1:500) with mouse heart tissue lysate 1840 ug.

LYRM5 Polyclonal Antibody for IP, ELISA

Cat No. 31548-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IP, ELISA

Synonyms

ETFRF1

---

Tested Applications

• Positive IP detected in: mouse heart tissue

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31548-1-AP targets LYRM5 in IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35889

  Product name: Recombinant human LYRM5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-88 aa of BC071769

  Sequence: MANSLRGEVLKLYKNLLYLGRDYPKGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELEALYFLRKYRAMKQRYYSDTNKTN

• Full Name: LYR motif containing 5
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC071769
• Gene Symbol: LYRM5
• Gene ID (NCBI): 144363
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6IPR1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LYRM5, also known as ETFRF1, belongs to the Complex1_LYR-like Superfamily. LYRM5 is a mitochondrial protein and plays key roles in acetate metabolism, and in essential Fe-S cluster biogenesis. In vitro, LYRM5 was found to inhibit ETF by promoting the removal of flavin from the ETF holoenzyme, thus potentially regulating the rate of β-oxidation (PMID: 35402183, PMID: 36266680). The calculated molecular weight of LYRM5 is 11 kDa.