Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, mouse tongue tissue, pig tongue tissue, rat skeletal muscle tissue, rat tongue tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31202-1-AP targets Leiomodin-2 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35312 Product name: Recombinant human LMOD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-120 aa of NM_207163.2 Sequence: MSTFGYRRGLSKYESIDEDELLASLSAEELKELERELEDIEPDRNLPVGLRQKSLTEKTPTGTFSREALMAYWEKESQKLLEKERLGECGKVAEDKEESEEELIFTESNSEVSEEVYTEE Predict reactive species |
| Full Name | leiomodin 2 (cardiac) |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 70-100 kDa |
| GenBank Accession Number | NM_207163.2 |
| Gene Symbol | LMOD2 |
| Gene ID (NCBI) | 442721 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q6P5Q4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Leiomodin-2 (Lmod2) is a striated muscle-specific actin-binding protein that plays a crucial role in the regulation of thin filament length and assembly in muscle cells. It is particularly important in cardiac and skeletal muscles. In the heart, Lmod2 is necessary for maintaining proper thin filament length, which is crucial for generating contractile force. Studies have shown that Lmod2 knockout in mice leads to dilated cardiomyopathy and rapid cardiac failure due to shorter and non-uniform thin filaments. Lmod2 is also essential for effective skeletal muscle contraction. Mutations or loss of Lmod2 can lead to significant impairments in muscle function. Mutations in the LMOD2 gene have been linked to severe neonatal and infantile dilated cardiomyopathy, a condition characterized by enlarged heart chambers and impaired contractility. Its observed molecular weight is 70-100 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Leiomodin-2 antibody 31202-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

