Leiomodin-2 Polyclonal antibody

Leiomodin-2 Polyclonal Antibody for WB, ELISA
Cat No. 31202-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, ELISA

LMOD2, Leiomodin 2, Cardiac leiomodin, C LMOD

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse skeletal muscle tissue, mouse tongue tissue, pig tongue tissue, rat skeletal muscle tissue, rat tongue tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31202-1-AP targets Leiomodin-2 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag35312

Product name: Recombinant human LMOD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-120 aa of NM_207163.2

Sequence: MSTFGYRRGLSKYESIDEDELLASLSAEELKELERELEDIEPDRNLPVGLRQKSLTEKTPTGTFSREALMAYWEKESQKLLEKERLGECGKVAEDKEESEEELIFTESNSEVSEEVYTEE

Predict reactive species
Full Name leiomodin 2 (cardiac)
Calculated Molecular Weight62 kDa
Observed Molecular Weight70-100 kDa
GenBank Accession NumberNM_207163.2
Gene Symbol LMOD2
Gene ID (NCBI) 442721
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ6P5Q4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Leiomodin-2 (Lmod2) is a striated muscle-specific actin-binding protein that plays a crucial role in the regulation of thin filament length and assembly in muscle cells. It is particularly important in cardiac and skeletal muscles. In the heart, Lmod2 is necessary for maintaining proper thin filament length, which is crucial for generating contractile force. Studies have shown that Lmod2 knockout in mice leads to dilated cardiomyopathy and rapid cardiac failure due to shorter and non-uniform thin filaments. Lmod2 is also essential for effective skeletal muscle contraction. Mutations or loss of Lmod2 can lead to significant impairments in muscle function. Mutations in the LMOD2 gene have been linked to severe neonatal and infantile dilated cardiomyopathy, a condition characterized by enlarged heart chambers and impaired contractility. Its observed molecular weight is 70-100 kDa.

Protocols

Product Specific Protocols
WB protocol for Leiomodin-2 antibody 31202-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...