MAGEA10 Polyclonal antibody, PBS Only

• 

  WB analysis of A375 using 15295-1-AP (same clone as 15295-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 15295-1-AP (MAGEA10 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15295-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 15295-1-AP (same clone as 15295-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15295-1-AP (MAGEA10 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15295-1-PBS in a different storage buffer formulation.

MAGEA10 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15295-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

15295-1-PBS targets MAGEA10 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7540

  Product name: Recombinant human MAGEA10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 39-369 aa of BC004105

  Sequence: SSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIKNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIIFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE

• Full Name: melanoma antigen family A, 10
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 62 kDa, 41 kDa
• GenBank Accession Number: BC004105
• Gene Symbol: MAGEA10
• Gene ID (NCBI): 4109
• RRID: AB_2137968
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43363
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.