MAGEF1 Polyclonal antibody, PBS Only

• 

  IHC staining of human testis using 24105-1-AP (same clone as 24105-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24105-1-AP (MAGEF1 Antibody) at dilution of 1:162 (under 10x lens). This data was developed using the same antibody clone with 24105-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 24105-1-AP (same clone as 24105-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24105-1-AP (MAGEF1 Antibody) at dilution of 1:162 (under 40x lens). This data was developed using the same antibody clone with 24105-1-PBS in a different storage buffer formulation.

MAGEF1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 24105-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

24105-1-PBS targets MAGEF1 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21147

  Product name: Recombinant human MAGEF1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-308 aa of BC010056

  Sequence: MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGARALAAKSLARRRAYRRLNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDLKILFPDIIARAAEHLRYVFGFELKQFDRKHHTYILINKLKPLEEEEEEEDLGGDGPRLGLLMMILGLIYMRGNSAREAQVWEMLRRLGVQPSKYHFLFGYPKRLIMEDFVQQRYLSYRRVPHTNPPAYEFSWGPRSNLEISKMEVLGFVAKLHKKEPQHWPVQYREALADEADRARAKARAEASMRARASARAGIHLW

• Full Name: melanoma antigen family F, 1
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: BC010056
• Gene Symbol: MAGEF1
• Gene ID (NCBI): 64110
• RRID: AB_2879433
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAY2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.