MAGOH Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MAGOH Polyclonal antibody (12347-1-AP)

MAGOH Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12347-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

MAGOHA

• 

  WB analysis using 12347-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12347-1-AP (MAGOH antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 12347-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 12347-1-AP (MAGOH Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 12347-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12347-1-AP (MAGOH antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 12347-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12347-1-AP (MAGOH antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 12347-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 12347-1-AP (MAGOH antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 12347-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 12347-1-AP (MAGOH antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 12347-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 12347-1-AP (MAGOH antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of K-562 using 12347-1-AP

  IP result of anti-MAGOH (IP:12347-1-AP, 3ug; Detection:12347-1-AP 1:500) with K-562 cells lysate 2400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 12347-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12347-1-AP (MAGOH antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 12347-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12347-1-AP (MAGOH antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MAGOH in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells, HeLa cells, human brain tissue, K-562 cells, Raji cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12347-1-AP targets MAGOH in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3004

  Product name: Recombinant human MAGOH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-146 aa of BC018211

  Sequence: MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI

• Full Name: mago-nashi homolog, proliferation-associated (Drosophila)
• Calculated Molecular Weight: 146 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC018211
• Gene Symbol: MAGOH
• Gene ID (NCBI): 4116
• RRID: AB_2265988
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61326
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAGOH, belonging to the mago nashi family, is a component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). MAGOH regulates the transcriptional activation of STAT3 by interfering complex formation between STAT3 and a core EJC component Y14.

Publications

What published studies show

The antibody (catalog no. 12347-1-AP) has 11 total citations across journals including Cell Metabolism, Nature Neuroscience, Nucleic Acids Research, Cancer Letters, Cell Reports, Development, PLoS Genetics, Genesis, Journal of Experimental Zoology B, and Aging. Research fields span neurodevelopment (neural stem cells, cortical interneurons, axon development), cancer biology (breast cancer metastasis, glioma, senescence), RNA biology (RNA helicases, splicing factors), and reproductive biology (spermatid development). Applications include WB, IHC, IF, and IP in human and mouse samples.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Metab; NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis.; Authors - Mi Kyung Park
mouse	IHC	Nat Neurosci; The exon junction complex component Magoh controls brain size by regulating neural stem cell division.; Authors - Silver Debra L DL
mouse	WB	Nucleic Acids Res; An RNAi screen of RNA helicases identifies eIF4A3 as a regulator of embryonic stem cell identity; Authors - Dan Li
human	WB	Cancer Lett; Splicing factor SF3B4 acts as a switch in cancer cell senescence by regulating p21 mRNA stability; Authors - Donghee Kang ; KD Validated
human	IF	Cell Rep; The RNA-binding protein EIF4A3 promotes axon development by direct control of the cytoskeleton; Authors - Fernando C Alsina
mouse	WB	Cell Rep; Revealing molecular pathways for cancer cell fitness through a genetic screen of the cancer translatome.; Authors - Duygu Kuzuoglu-Ozturk