Tested Applications
| Positive WB detected in | HL-60 cells, HeLa cells, human brain tissue, K-562 cells, Raji cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12347-1-AP targets MAGOH in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3004 Product name: Recombinant human MAGOH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-146 aa of BC018211 Sequence: MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI Predict reactive species |
| Full Name | mago-nashi homolog, proliferation-associated (Drosophila) |
| Calculated Molecular Weight | 146 aa, 17 kDa |
| Observed Molecular Weight | 17 kDa |
| GenBank Accession Number | BC018211 |
| Gene Symbol | MAGOH |
| Gene ID (NCBI) | 4116 |
| RRID | AB_2265988 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61326 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MAGOH, belonging to the mago nashi family, is a component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). MAGOH regulates the transcriptional activation of STAT3 by interfering complex formation between STAT3 and a core EJC component Y14.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MAGOH antibody 12347-1-AP | Download protocol |
| IP protocol for MAGOH antibody 12347-1-AP | Download protocol |
| WB protocol for MAGOH antibody 12347-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The antibody (catalog no. 12347-1-AP) has 11 total citations across journals including Cell Metabolism, Nature Neuroscience, Nucleic Acids Research, Cancer Letters, Cell Reports, Development, PLoS Genetics, Genesis, Journal of Experimental Zoology B, and Aging. Research fields span neurodevelopment (neural stem cells, cortical interneurons, axon development), cancer biology (breast cancer metastasis, glioma, senescence), RNA biology (RNA helicases, splicing factors), and reproductive biology (spermatid development). Applications include WB, IHC, IF, and IP in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Cell Metab NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis. | ||
Nat Neurosci The exon junction complex component Magoh controls brain size by regulating neural stem cell division. | ||
Nucleic Acids Res An RNAi screen of RNA helicases identifies eIF4A3 as a regulator of embryonic stem cell identity | ||
Cancer Lett Splicing factor SF3B4 acts as a switch in cancer cell senescence by regulating p21 mRNA stability
| ||
Cell Rep The RNA-binding protein EIF4A3 promotes axon development by direct control of the cytoskeleton | ||
Cell Rep Revealing molecular pathways for cancer cell fitness through a genetic screen of the cancer translatome. |



















