MAP4K3 Polyclonal antibody, PBS Only

• 

  WB analysis using 30716-1-AP (same clone as 30716-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30716-1-AP (MAP4K3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30716-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 30716-1-AP (same clone as 30716-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 30716-1-AP (MAP4K3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30716-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 30716-1-AP (same clone as 30716-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 30716-1-AP (MAP4K3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30716-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-87 MG using 30716-1-AP (same clone as 30716-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-87 MG cells using MAP4K3 antibody (30716-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 30716-1-PBS in a different storage buffer formulation.

MAP4K3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30716-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

MEKKK 3, MEK kinase kinase 3, MAPKKKK3, GLK, Germinal center kinase-related protein kinase

---

Product Information

30716-1-PBS targets MAP4K3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33512

  Product name: Recombinant human MAP4K3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 345-515 aa of BC071579

  Sequence: ETEPHHELDLQLEYGQGHQGGYFLGANKSLLKSVEEELHQRGHVAHLEDDEGDDDESKHSTLKAKIPPPLPPKPKSIFIPQEMHSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRLPPHKPVALGNGMSSFQLNGERDGSLCQQQNEHRGTNLSRKEKKDVPKPISNGL

• Full Name: mitogen-activated protein kinase kinase kinase kinase 3
• Calculated Molecular Weight: 101 kDa
• Observed Molecular Weight: 99-101 kDa
• GenBank Accession Number: BC071579
• Gene Symbol: MAP4K3
• Gene ID (NCBI): 8491
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IVH8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MAP4K3(Mitogen-activated protein kinase kinase kinase kinase 3) has kinase activity and that it activates JNK but not MAPK1, MAPK3 or MAPK14 through the activation of MAP3K1 and MAP2K4. Endogenous MAP4K3 kinase activity could be stimulated by exposure to ultraviolet radiation or to tumor necrosis factor.